| Root: SCOPe 2.08 |
| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
| Domain d6cx5c2: 6cx5 C:116-204 [367320] Other proteins in same PDB: d6cx5a1, d6cx5a2, d6cx5b_, d6cx5c1, d6cx5d1, d6cx5d2 automated match to d2pyfa2 complexed with fjm, na, nag, plm |
PDB Entry: 6cx5 (more details), 2.4 Å
SCOPe Domain Sequences for d6cx5c2:
Sequence, based on SEQRES records: (download)
>d6cx5c2 b.1.1.2 (C:116-204) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps
>d6cx5c2 b.1.1.2 (C:116-204) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqdsdvyitdkcvldmrsmdfksnsav
awsnkdfacanafnnsiipedtffps
Timeline for d6cx5c2: