Lineage for d6cx5a1 (6cx5 A:7-185)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2507530Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2507531Protein automated matches [226842] (4 species)
    not a true protein
  7. 2507687Species Mouse (Mus musculus) [TaxId:10090] [224924] (65 PDB entries)
  8. 3067337Domain d6cx5a1: 6cx5 A:7-185 [367399]
    Other proteins in same PDB: d6cx5a2, d6cx5b_, d6cx5c1, d6cx5c2, d6cx5d1, d6cx5d2
    automated match to d1zt4c2
    complexed with fjm, fuc, na, nag, plm

Details for d6cx5a1

PDB Entry: 6cx5 (more details), 2.4 Å

PDB Description: structure of alpha-gsa[8,8p] bound by cd1d and in complex with the va14vb8.2 tcr
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d6cx5a1:

Sequence, based on SEQRES records: (download)

>d6cx5a1 d.19.1.0 (A:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Sequence, based on observed residues (ATOM records): (download)

>d6cx5a1 d.19.1.0 (A:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgsesflhvafqgkyvvrf
wgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d6cx5a1:

Click to download the PDB-style file with coordinates for d6cx5a1.
(The format of our PDB-style files is described here.)

Timeline for d6cx5a1:

  • d6cx5a1 appears in periodic updates to SCOPe 2.07 starting on 2019-04-11