SCOPe 2.08: Domain d6c2mc1: 6c2m C:1004-1179

Lineage for d6c2mc1 (6c2m C:1004-1179)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein automated matches [190658] (12 species)
   not a true protein

7. Species Hepatitis C virus [TaxId:11103] [189262] (15 PDB entries)

8. Domain d6c2mc1: 6c2m C:1004-1179 [362027]
   Other proteins in same PDB: d6c2ma2, d6c2mb2, d6c2mc2, d6c2md2
   automated match to d5epna_
   complexed with so4, sue, zn

Details for d6c2mc1

PDB Entry: 6c2m, 1.86 Å

PDB Description: crystal structure of hcv ns3/4a protease variant y56h in complex with mk-5172

PDB Compounds: (C:) NS3 protease

SCOPe Domain Sequences for d6c2mc1:

Sequence; same for both SEQRES and ATOM records:

>d6c2mc1 b.47.1.3 (C:1004-1179) automated matches {Hepatitis C virus [TaxId: 11103]}
tayaqqtrgeegcqetsqtgrdknqvegevqivstatqtflatsingvlwtvhhgagtrt
iaspkgpvtqmytnvdkdlvgwqapqgsrsltpctcgssdlylvtrhadvipvrrrgdsr
gsllsprpisylkgssggpllcpaghavgifraavstrgvakavdfipveslettm

Timeline for d6c2mc1:

• d6c2mc1 first appeared in SCOPe 2.07