Lineage for d6c2md1 (6c2m D:1004-1179)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2389767Family b.47.1.3: Viral proteases [50596] (5 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 2389857Protein automated matches [190658] (8 species)
    not a true protein
  7. 2389898Species Hepatitis C virus [TaxId:11103] [189262] (14 PDB entries)
  8. 3061948Domain d6c2md1: 6c2m D:1004-1179 [362010]
    Other proteins in same PDB: d6c2ma2, d6c2mb2, d6c2mc2, d6c2md2
    automated match to d5epna_
    complexed with so4, sue, zn

Details for d6c2md1

PDB Entry: 6c2m (more details), 1.86 Å

PDB Description: crystal structure of hcv ns3/4a protease variant y56h in complex with mk-5172
PDB Compounds: (D:) NS3 protease

SCOPe Domain Sequences for d6c2md1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c2md1 b.47.1.3 (D:1004-1179) automated matches {Hepatitis C virus [TaxId: 11103]}
tayaqqtrgeegcqetsqtgrdknqvegevqivstatqtflatsingvlwtvhhgagtrt
iaspkgpvtqmytnvdkdlvgwqapqgsrsltpctcgssdlylvtrhadvipvrrrgdsr
gsllsprpisylkgssggpllcpaghavgifraavstrgvakavdfipveslettm

SCOPe Domain Coordinates for d6c2md1:

Click to download the PDB-style file with coordinates for d6c2md1.
(The format of our PDB-style files is described here.)

Timeline for d6c2md1:

  • d6c2md1 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17