SCOPe 2.08: Domain d6flca1: 6flc A:1-107

Lineage for d6flca1 (6flc A:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d6flca1: 6flc A:1-107 [359292]
   Other proteins in same PDB: d6flca2, d6flcb_, d6flcg_, d6flch_, d6flci_, d6flcl2
   automated match to d1gm3l1
   complexed with gol

Details for d6flca1

PDB Entry: 6flc, 2 Å

PDB Description: 2c8 fab bound to ediii of denv 2

PDB Compounds: (A:) Light chain of 2C8 Fab

SCOPe Domain Sequences for d6flca1:

Sequence; same for both SEQRES and ATOM records:

>d6flca1 b.1.1.0 (A:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqspaslsvsvgetvtitcratkniynnlawyqqkqgrspqllvyaatnladgvps
rfsgsgsgtqfslrinslqsedfgnyycqhfwhtpwtfgggtkleik

Timeline for d6flca1:

• d6flca1 first appeared in SCOPe 2.07