Lineage for d6flca1 (6flc A:1-107)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2357727Species Mouse (Mus musculus) [TaxId:10090] [188198] (630 PDB entries)
  8. 3059230Domain d6flca1: 6flc A:1-107 [359292]
    Other proteins in same PDB: d6flca2, d6flcg_, d6flci_, d6flcl2
    automated match to d1gm3l1
    complexed with gol

Details for d6flca1

PDB Entry: 6flc (more details), 2 Å

PDB Description: 2c8 fab bound to ediii of denv 2
PDB Compounds: (A:) Light chain of 2C8 Fab

SCOPe Domain Sequences for d6flca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6flca1 b.1.1.0 (A:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqspaslsvsvgetvtitcratkniynnlawyqqkqgrspqllvyaatnladgvps
rfsgsgsgtqfslrinslqsedfgnyycqhfwhtpwtfgggtkleik

SCOPe Domain Coordinates for d6flca1:

Click to download the PDB-style file with coordinates for d6flca1.
(The format of our PDB-style files is described here.)

Timeline for d6flca1:

  • d6flca1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-25