Lineage for d6flcg_ (6flc G:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2361840Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2362223Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)
  6. 2362267Protein automated matches [190183] (8 species)
    not a true protein
  7. 3059178Species Dengue virus 2 [TaxId:11060] [359240] (2 PDB entries)
  8. 3059179Domain d6flcg_: 6flc G: [359241]
    Other proteins in same PDB: d6flca1, d6flca2, d6flcl1, d6flcl2
    automated match to d3uzva_
    complexed with gol

Details for d6flcg_

PDB Entry: 6flc (more details), 2 Å

PDB Description: 2c8 fab bound to ediii of denv 2
PDB Compounds: (G:) Domain III of Dengue virus 2

SCOPe Domain Sequences for d6flcg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6flcg_ b.1.18.4 (G:) automated matches {Dengue virus 2 [TaxId: 11060]}
msysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnp
ivtekdspvnieaeppfgdsyiiigvepgqlklnwfkk

SCOPe Domain Coordinates for d6flcg_:

Click to download the PDB-style file with coordinates for d6flcg_.
(The format of our PDB-style files is described here.)

Timeline for d6flcg_:

  • d6flcg_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-25