Lineage for d6flcl2 (6flc L:108-212)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (15 species)
    not a true protein
  7. 2353824Species Mouse (Mus musculus) [TaxId:10090] [224855] (538 PDB entries)
  8. 3059217Domain d6flcl2: 6flc L:108-212 [359279]
    Other proteins in same PDB: d6flca1, d6flcg_, d6flci_, d6flcl1
    automated match to d1h3pl2
    complexed with gol

Details for d6flcl2

PDB Entry: 6flc (more details), 2 Å

PDB Description: 2c8 fab bound to ediii of denv 2
PDB Compounds: (L:) Light chain of 2C8 Fab

SCOPe Domain Sequences for d6flcl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6flcl2 b.1.1.2 (L:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d6flcl2:

Click to download the PDB-style file with coordinates for d6flcl2.
(The format of our PDB-style files is described here.)

Timeline for d6flcl2:

  • d6flcl2 appears in periodic updates to SCOPe 2.07 starting on 2018-10-25