SCOPe 2.08: Domain d6bfql1: 6bfq L:2-108

Lineage for d6bfql1 (6bfq L:2-108)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6bfql1: 6bfq L:2-108 [357279]
   Other proteins in same PDB: d6bfqb2, d6bfqd2, d6bfqf2, d6bfqg1, d6bfqg2, d6bfqi1, d6bfqi2, d6bfqj1, d6bfqj2, d6bfqk1, d6bfqk2, d6bfql2
   automated match to d1um5l1

Details for d6bfql1

PDB Entry: 6bfq, 2.6 Å

PDB Description: the mechanism of gm-csf inhibition by human gm-csf auto-antibodies

PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d6bfql1:

Sequence; same for both SEQRES and ATOM records:

>d6bfql1 b.1.1.0 (L:2-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspssvsasvgdrvtitcrasqginrrlawyqqkpgkapkrliyavstlqsgvps
rfngsgsgtdftltvnnvqpddlamyfclqsnnypltfgggtkveik

Timeline for d6bfql1:

• d6bfql1 first appeared in SCOPe 2.07