Lineage for d6bfqd2 (6bfq D:109-214)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (808 PDB entries)
  8. 3057215Domain d6bfqd2: 6bfq D:109-214 [357277]
    Other proteins in same PDB: d6bfqb1, d6bfqd1, d6bfqf1, d6bfqg1, d6bfqg2, d6bfqi1, d6bfqi2, d6bfqj1, d6bfqj2, d6bfqk1, d6bfqk2, d6bfql1
    automated match to d1um5l2

Details for d6bfqd2

PDB Entry: 6bfq (more details), 2.6 Å

PDB Description: the mechanism of gm-csf inhibition by human gm-csf auto-antibodies
PDB Compounds: (D:) Fab light chain

SCOPe Domain Sequences for d6bfqd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bfqd2 b.1.1.2 (D:109-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d6bfqd2:

Click to download the PDB-style file with coordinates for d6bfqd2.
(The format of our PDB-style files is described here.)

Timeline for d6bfqd2:

  • d6bfqd2 appears in periodic updates to SCOPe 2.07 starting on 2018-09-13