![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily) core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest |
![]() | Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families) ![]() automatically mapped to Pfam PF00510 |
![]() | Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins) function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel |
![]() | Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81444] (57 PDB entries) |
![]() | Domain d5zcqc_: 5zcq C: [357154] Other proteins in same PDB: d5zcqa_, d5zcqb1, d5zcqb2, d5zcqd_, d5zcqe_, d5zcqf_, d5zcqg_, d5zcqh_, d5zcqi_, d5zcqj_, d5zcqk_, d5zcql_, d5zcqm_, d5zcqn_, d5zcqo1, d5zcqo2, d5zcqq_, d5zcqr_, d5zcqs_, d5zcqt_, d5zcqu_, d5zcqv_, d5zcqw_, d5zcqx_, d5zcqy_, d5zcqz_ automated match to d1v54c_ complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 5zcq (more details), 1.65 Å
SCOPe Domain Sequences for d5zcqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zcqc_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]} hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw hfvdvvwlflyvsiywwgs
Timeline for d5zcqc_:
![]() Domains from other chains: (mouse over for more information) d5zcqa_, d5zcqb1, d5zcqb2, d5zcqd_, d5zcqe_, d5zcqf_, d5zcqg_, d5zcqh_, d5zcqi_, d5zcqj_, d5zcqk_, d5zcql_, d5zcqm_, d5zcqn_, d5zcqo1, d5zcqo2, d5zcqp_, d5zcqq_, d5zcqr_, d5zcqs_, d5zcqt_, d5zcqu_, d5zcqv_, d5zcqw_, d5zcqx_, d5zcqy_, d5zcqz_ |