PDB entry 5zcq

View 5zcq on RCSB PDB site
Description: Azide-bound cytochrome c oxidase structure determined using the crystals exposed to 10 mM azide solution for 2 days
Class: oxidoreductase
Keywords: metalloenzyme cytochrome c oxidase proton pump bioenergetics heme copper, MEMBRANE PROTEIN, OXIDOREDUCTASE
Deposited on 2018-02-19, released 2018-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-15, with a file datestamp of 2018-08-10.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c oxidase subunit 1
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zcqa_
  • Chain 'B':
    Compound: Cytochrome c oxidase subunit 2
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Cytochrome c oxidase subunit 3
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: cytochrome c oxidase subunit 4 isoform 1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zcqd_
  • Chain 'E':
    Compound: cytochrome c oxidase subunit 5a, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zcqe_
  • Chain 'F':
    Compound: cytochrome c oxidase subunit 5b, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Cytochrome c oxidase subunit 6A2, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zcqg_
  • Chain 'H':
    Compound: Cytochrome c oxidase subunit 6B1
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zcqh_
  • Chain 'I':
    Compound: Cytochrome c oxidase subunit 6C
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zcqi_
  • Chain 'J':
    Compound: cytochrome c oxidase subunit 7a1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zcqj_
  • Chain 'K':
    Compound: cytochrome c oxidase subunit 7b, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zcqk_
  • Chain 'L':
    Compound: cytochrome c oxidase subunit 7c, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zcql_
  • Chain 'M':
    Compound: cytochrome c oxidase subunit 8b, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zcqm_
  • Chain 'N':
    Compound: Cytochrome c oxidase subunit 1
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zcqn_
  • Chain 'O':
    Compound: Cytochrome c oxidase subunit 2
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: Cytochrome c oxidase subunit 3
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: cytochrome c oxidase subunit 4 isoform 1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zcqq_
  • Chain 'R':
    Compound: cytochrome c oxidase subunit 5a, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zcqr_
  • Chain 'S':
    Compound: cytochrome c oxidase subunit 5b, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: Cytochrome c oxidase subunit 6A2, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: Cytochrome c oxidase subunit 6B1
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: Cytochrome c oxidase subunit 6C
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: cytochrome c oxidase subunit 7a1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: cytochrome c oxidase subunit 7b, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: cytochrome c oxidase subunit 7c, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'Z':
    Compound: cytochrome c oxidase subunit 8b, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HEA, CU, MG, NA, AZI, TGL, PGV, EDO, CHD, CUA, PSC, DMU, UNX, CDL, PEK, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zcqA (A:)
    mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
    hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
    gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
    tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
    pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
    trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
    ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
    vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
    evltvdltttnlewlngcpppyhtfeeptyvnlk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5zcqD (D:)
    ahgsvvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvely
    rlkfkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqt
    krmldmkvapiqgfsakwdydknewkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zcqD (D:)
    svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
    fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
    ldmkvapiqgfsakwdydknewkk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5zcqE (E:)
    shgshetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlnd
    fasavrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zcqE (E:)
    hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
    vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5zcqG (G:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyekp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zcqG (G:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyek
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5zcqH (H:)
    aediqakiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvy
    kslcpiswvstwddrraegtfpgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zcqH (H:)
    kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
    swvstwddrraegtfpgki
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zcqI (I:)
    stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
    eemrkagifqsak
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5zcqJ (J:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zcqJ (J:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5zcqK (K:)
    ihqkrapdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewreq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zcqK (K:)
    apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5zcqL (L:)
    shyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zcqL (L:)
    hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5zcqM (M:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykkssaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zcqM (M:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zcqN (N:)
    mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
    hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
    gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
    tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
    pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
    trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
    ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
    vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
    evltvdltttnlewlngcpppyhtfeeptyvnlk
    

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >5zcqQ (Q:)
    ahgsvvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvely
    rlkfkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqt
    krmldmkvapiqgfsakwdydknewkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zcqQ (Q:)
    svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
    fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
    ldmkvapiqgfsakwdydknewkk
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >5zcqR (R:)
    shgshetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlnd
    fasavrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zcqR (R:)
    hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
    vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    No sequence available.