SCOPe 2.08: Domain d5zcqu_: 5zcq U:

Lineage for d5zcqu_ (5zcq U:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
   4 helices; irregular array, disulfide-linked

4. Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families)

5. Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)

6. Protein Cytochrome c oxidase subunit h [47696] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47697] (33 PDB entries)

8. Domain d5zcqu_: 5zcq U: [357155]
   Other proteins in same PDB: d5zcqa_, d5zcqb1, d5zcqb2, d5zcqc_, d5zcqd_, d5zcqe_, d5zcqf_, d5zcqg_, d5zcqh_, d5zcqi_, d5zcqj_, d5zcqk_, d5zcql_, d5zcqm_, d5zcqn_, d5zcqo1, d5zcqo2, d5zcqp_, d5zcqq_, d5zcqr_, d5zcqs_, d5zcqt_, d5zcqv_, d5zcqw_, d5zcqx_, d5zcqy_, d5zcqz_
   automated match to d1v54h_
   complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5zcqu_

PDB Entry: 5zcq, 1.65 Å

PDB Description: azide-bound cytochrome c oxidase structure determined using the crystals exposed to 10 mm azide solution for 2 days

PDB Compounds: (U:) Cytochrome c oxidase subunit 6B1

SCOPe Domain Sequences for d5zcqu_:

Sequence; same for both SEQRES and ATOM records:

>d5zcqu_ a.51.1.1 (U:) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

Timeline for d5zcqu_:

• d5zcqu_ first appeared in SCOPe 2.07