Lineage for d5zcqq_ (5zcq Q:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577985Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2577986Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family) (S)
    automatically mapped to Pfam PF02936
  5. 2577987Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (2 proteins)
  6. 2578025Protein automated matches [190270] (1 species)
    not a true protein
  7. 2578026Species Cow (Bos taurus) [TaxId:9913] [187062] (25 PDB entries)
  8. 3056209Domain d5zcqq_: 5zcq Q: [356271]
    Other proteins in same PDB: d5zcqa_, d5zcqe_, d5zcqg_, d5zcqh_, d5zcqi_, d5zcqj_, d5zcqk_, d5zcql_, d5zcqm_, d5zcqn_, d5zcqr_
    automated match to d1v54d_
    complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5zcqq_

PDB Entry: 5zcq (more details), 1.65 Å

PDB Description: azide-bound cytochrome c oxidase structure determined using the crystals exposed to 10 mm azide solution for 2 days
PDB Compounds: (Q:) cytochrome c oxidase subunit 4 isoform 1, mitochondrial

SCOPe Domain Sequences for d5zcqq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zcqq_ f.23.1.1 (Q:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk

SCOPe Domain Coordinates for d5zcqq_:

Click to download the PDB-style file with coordinates for d5zcqq_.
(The format of our PDB-style files is described here.)

Timeline for d5zcqq_:

  • d5zcqq_ appears in periodic updates to SCOPe 2.07 starting on 2018-08-16