Lineage for d5zcqp_ (5zcq P:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2579677Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 2579678Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) (S)
    automatically mapped to Pfam PF00510
  5. 2579679Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 2579692Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)
  7. 2579693Species Cow (Bos taurus) [TaxId:9913] [81444] (44 PDB entries)
  8. 3057073Domain d5zcqp_: 5zcq P: [357135]
    Other proteins in same PDB: d5zcqb1, d5zcqb2, d5zcqf_, d5zcqo1, d5zcqo2, d5zcqs_, d5zcqt_, d5zcqu_, d5zcqv_, d5zcqw_, d5zcqx_, d5zcqy_, d5zcqz_
    automated match to d1v54c_
    complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5zcqp_

PDB Entry: 5zcq (more details), 1.65 Å

PDB Description: azide-bound cytochrome c oxidase structure determined using the crystals exposed to 10 mm azide solution for 2 days
PDB Compounds: (P:) Cytochrome c oxidase subunit 3

SCOPe Domain Sequences for d5zcqp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zcqp_ f.25.1.1 (P:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

SCOPe Domain Coordinates for d5zcqp_:

Click to download the PDB-style file with coordinates for d5zcqp_.
(The format of our PDB-style files is described here.)

Timeline for d5zcqp_:

  • d5zcqp_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-06