Lineage for d6cwtd1 (6cwt D:2-108)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2761410Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (30 PDB entries)
  8. 2761527Domain d6cwtd1: 6cwt D:2-108 [356693]
    Other proteins in same PDB: d6cwtb2, d6cwtd2, d6cwte_, d6cwtf_
    automated match to d5tpnl1

Details for d6cwtd1

PDB Entry: 6cwt (more details), 3.15 Å

PDB Description: hepatitis b core-antigen in complex with fab e21
PDB Compounds: (D:) Fab e21 light chain

SCOPe Domain Sequences for d6cwtd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cwtd1 b.1.1.0 (D:2-108) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
elvmtqtpsstsaavggtvtincqasqsignalawyqqkpgqppkllisagsnlasgvps
rfrgsgsgteytltisdvqredaatyyclgtysaidrafgagtnvei

SCOPe Domain Coordinates for d6cwtd1:

Click to download the PDB-style file with coordinates for d6cwtd1.
(The format of our PDB-style files is described here.)

Timeline for d6cwtd1: