Lineage for d6cwtd2 (6cwt D:109-209)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2354653Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [226687] (4 PDB entries)
  8. 3056632Domain d6cwtd2: 6cwt D:109-209 [356694]
    Other proteins in same PDB: d6cwtb1, d6cwtd1, d6cwte_, d6cwtf_
    automated match to d5tpnl2

Details for d6cwtd2

PDB Entry: 6cwt (more details), 3.15 Å

PDB Description: hepatitis b core-antigen in complex with fab e21
PDB Compounds: (D:) Fab e21 light chain

SCOPe Domain Sequences for d6cwtd2:

Sequence, based on SEQRES records: (download)

>d6cwtd2 b.1.1.2 (D:109-209) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ertvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Sequence, based on observed residues (ATOM records): (download)

>d6cwtd2 b.1.1.2 (D:109-209) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ertvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d6cwtd2:

Click to download the PDB-style file with coordinates for d6cwtd2.
(The format of our PDB-style files is described here.)

Timeline for d6cwtd2:

  • d6cwtd2 appears in periodic updates to SCOPe 2.07 starting on 2018-08-30