Lineage for d6cwtf_ (6cwt F:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325511Fold a.62: Hepatitis B viral capsid (hbcag) [47851] (1 superfamily)
    5 helices; array; two long helices form a hairpin that dimerizes into a 4-helical bundle
  4. 2325512Superfamily a.62.1: Hepatitis B viral capsid (hbcag) [47852] (1 family) (S)
    automatically mapped to Pfam PF00906
  5. 2325513Family a.62.1.1: Hepatitis B viral capsid (hbcag) [47853] (2 proteins)
  6. 2325520Protein automated matches [191131] (2 species)
    not a true protein
  7. 2325521Species Hepatitis B virus genotype d subtype adw [TaxId:10419] [189224] (3 PDB entries)
  8. 3056746Domain d6cwtf_: 6cwt F: [356808]
    Other proteins in same PDB: d6cwtb1, d6cwtb2, d6cwtd1, d6cwtd2
    automated match to d4bmga_

Details for d6cwtf_

PDB Entry: 6cwt (more details), 3.15 Å

PDB Description: hepatitis b core-antigen in complex with fab e21
PDB Compounds: (F:) capsid protein

SCOPe Domain Sequences for d6cwtf_:

Sequence, based on SEQRES records: (download)

>d6cwtf_ a.62.1.1 (F:) automated matches {Hepatitis B virus genotype d subtype adw [TaxId: 10419]}
idpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehasphhtalrqailcw
gdlmtlatwvgtnledpasrdlvvsyvntnvglkfrqllwfhisaltfgretvleylvsf
gvwirtppayrppnapi

Sequence, based on observed residues (ATOM records): (download)

>d6cwtf_ a.62.1.1 (F:) automated matches {Hepatitis B virus genotype d subtype adw [TaxId: 10419]}
idpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehasphhtalrqailcw
gdlmtlatwvgntnvglkfrqllwfhisaltfgretvleylvsfgvwirtppayrppnap
i

SCOPe Domain Coordinates for d6cwtf_:

Click to download the PDB-style file with coordinates for d6cwtf_.
(The format of our PDB-style files is described here.)

Timeline for d6cwtf_:

  • d6cwtf_ appears in periodic updates to SCOPe 2.07 starting on 2018-08-30