| Root: SCOPe 2.08 |
| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family) ![]() automatically mapped to Pfam PF02285 |
| Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (2 proteins) |
| Protein automated matches [190273] (1 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [187065] (26 PDB entries) |
| Domain d5zcom_: 5zco M: [356278] Other proteins in same PDB: d5zcoa_, d5zcob1, d5zcob2, d5zcoc_, d5zcod_, d5zcoe_, d5zcof_, d5zcog_, d5zcoh_, d5zcoi_, d5zcoj_, d5zcok_, d5zcol_, d5zcon_, d5zcoo1, d5zcoo2, d5zcop_, d5zcoq_, d5zcor_, d5zcos_, d5zcot_, d5zcou_, d5zcov_, d5zcow_, d5zcox_, d5zcoy_ automated match to d1v54m_ complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 5zco (more details), 1.9 Å
SCOPe Domain Sequences for d5zcom_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zcom_ f.23.7.1 (M:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks
Timeline for d5zcom_:
View in 3DDomains from other chains: (mouse over for more information) d5zcoa_, d5zcob1, d5zcob2, d5zcoc_, d5zcod_, d5zcoe_, d5zcof_, d5zcog_, d5zcoh_, d5zcoi_, d5zcoj_, d5zcok_, d5zcol_, d5zcon_, d5zcoo1, d5zcoo2, d5zcop_, d5zcoq_, d5zcor_, d5zcos_, d5zcot_, d5zcou_, d5zcov_, d5zcow_, d5zcox_, d5zcoy_, d5zcoz_ |