SCOPe 2.07: Domain d5zcok_: 5zco K:

Lineage for d5zcok_ (5zco K:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family)
   automatically mapped to Pfam PF05392

5. Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins)

6. Protein automated matches [190272] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187064] (25 PDB entries)

8. Domain d5zcok_: 5zco K: [356261]
   Other proteins in same PDB: d5zcoa_, d5zcob1, d5zcob2, d5zcoc_, d5zcod_, d5zcoe_, d5zcof_, d5zcog_, d5zcoh_, d5zcoi_, d5zcoj_, d5zcol_, d5zcom_, d5zcon_, d5zcoo1, d5zcoo2, d5zcop_, d5zcoq_, d5zcor_, d5zcos_, d5zcot_, d5zcou_, d5zcov_, d5zcow_, d5zcoy_, d5zcoz_
   automated match to d1v54k_
   complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5zcok_

PDB Entry: 5zco, 1.9 Å

PDB Description: azide-bound cytochrome c oxidase structure determined using the crystals exposed to 2 mm azide solution for 2 days

PDB Compounds: (K:) cytochrome c oxidase subunit 7b, mitochondrial

SCOPe Domain Sequences for d5zcok_:

Sequence; same for both SEQRES and ATOM records:

>d5zcok_ f.23.5.1 (K:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

Timeline for d5zcok_:

• d5zcok_ appears in periodic updates to SCOPe 2.07 starting on 2018-08-16