![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family) ![]() automatically mapped to Pfam PF02936 |
![]() | Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (2 proteins) |
![]() | Protein automated matches [190270] (1 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [187062] (26 PDB entries) |
![]() | Domain d5zcoq_: 5zco Q: [356218] Other proteins in same PDB: d5zcoa_, d5zcob1, d5zcob2, d5zcoc_, d5zcoe_, d5zcof_, d5zcog_, d5zcoh_, d5zcoi_, d5zcoj_, d5zcok_, d5zcol_, d5zcom_, d5zcon_, d5zcoo1, d5zcoo2, d5zcop_, d5zcor_, d5zcos_, d5zcot_, d5zcou_, d5zcov_, d5zcow_, d5zcox_, d5zcoy_, d5zcoz_ automated match to d1v54d_ complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 5zco (more details), 1.9 Å
SCOPe Domain Sequences for d5zcoq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zcoq_ f.23.1.1 (Q:) automated matches {Cow (Bos taurus) [TaxId: 9913]} svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm ldmkvapiqgfsakwdydknewkk
Timeline for d5zcoq_:
![]() Domains from other chains: (mouse over for more information) d5zcoa_, d5zcob1, d5zcob2, d5zcoc_, d5zcod_, d5zcoe_, d5zcof_, d5zcog_, d5zcoh_, d5zcoi_, d5zcoj_, d5zcok_, d5zcol_, d5zcom_, d5zcon_, d5zcoo1, d5zcoo2, d5zcop_, d5zcor_, d5zcos_, d5zcot_, d5zcou_, d5zcov_, d5zcow_, d5zcox_, d5zcoy_, d5zcoz_ |