Lineage for d5zcob1 (5zco B:1-90)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3023860Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 3024004Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 3024167Family f.17.2.0: automated matches [227239] (1 protein)
    not a true family
  6. 3024168Protein automated matches [226999] (2 species)
    not a true protein
  7. 3024169Species Cow (Bos taurus) [TaxId:9913] [255751] (7 PDB entries)
  8. 3024178Domain d5zcob1: 5zco B:1-90 [356297]
    Other proteins in same PDB: d5zcoa_, d5zcob2, d5zcoc_, d5zcod_, d5zcoe_, d5zcof_, d5zcog_, d5zcoh_, d5zcoi_, d5zcoj_, d5zcok_, d5zcol_, d5zcom_, d5zcon_, d5zcoo2, d5zcop_, d5zcoq_, d5zcor_, d5zcos_, d5zcot_, d5zcou_, d5zcov_, d5zcow_, d5zcox_, d5zcoy_, d5zcoz_
    automated match to d3ag3b1
    complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5zcob1

PDB Entry: 5zco (more details), 1.9 Å

PDB Description: azide-bound cytochrome c oxidase structure determined using the crystals exposed to 2 mm azide solution for 2 days
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d5zcob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zcob1 f.17.2.0 (B:1-90) automated matches {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

SCOPe Domain Coordinates for d5zcob1:

Click to download the PDB-style file with coordinates for d5zcob1.
(The format of our PDB-style files is described here.)

Timeline for d5zcob1: