Lineage for d5zcoj_ (5zco J:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025133Superfamily f.23.4: Mitochondrial cytochrome c oxidase subunit VIIa [81419] (1 family) (S)
    automatically mapped to Pfam PF02238
  5. 3025134Family f.23.4.1: Mitochondrial cytochrome c oxidase subunit VIIa [81418] (2 proteins)
  6. 3025135Protein Mitochondrial cytochrome c oxidase subunit VIIa [81417] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 3025136Species Cow (Bos taurus) [TaxId:9913] [81416] (56 PDB entries)
  8. 3025206Domain d5zcoj_: 5zco J: [356318]
    Other proteins in same PDB: d5zcoa_, d5zcob1, d5zcob2, d5zcoc_, d5zcod_, d5zcoe_, d5zcof_, d5zcog_, d5zcoh_, d5zcoi_, d5zcok_, d5zcol_, d5zcom_, d5zcon_, d5zcoo1, d5zcoo2, d5zcop_, d5zcoq_, d5zcor_, d5zcos_, d5zcot_, d5zcou_, d5zcov_, d5zcox_, d5zcoy_, d5zcoz_
    automated match to d3ag3j_
    complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5zcoj_

PDB Entry: 5zco (more details), 1.9 Å

PDB Description: azide-bound cytochrome c oxidase structure determined using the crystals exposed to 2 mm azide solution for 2 days
PDB Compounds: (J:) cytochrome c oxidase subunit 7a1, mitochondrial

SCOPe Domain Sequences for d5zcoj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zcoj_ f.23.4.1 (J:) Mitochondrial cytochrome c oxidase subunit VIIa {Cow (Bos taurus) [TaxId: 9913]}
fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphk

SCOPe Domain Coordinates for d5zcoj_:

Click to download the PDB-style file with coordinates for d5zcoj_.
(The format of our PDB-style files is described here.)

Timeline for d5zcoj_: