SCOPe 2.08: Domain d5ovwh1: 5ovw H:24-148

Lineage for d5ovwh1 (5ovw H:24-148)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d5ovwh1: 5ovw H:24-148 [341341]
   Other proteins in same PDB: d5ovwa_, d5ovwb_, d5ovwc_, d5ovwd_, d5ovwe_, d5ovwf_, d5ovwg2, d5ovwh2, d5ovwi2, d5ovwj2, d5ovwk2, d5ovwl2
   automated match to d4grwf_
   complexed with gol

Details for d5ovwh1

PDB Entry: 5ovw, 2.65 Å

PDB Description: nanobody-bound btuf, the vitamin b12 binding protein in escherichia coli

PDB Compounds: (H:) Nanobody

SCOPe Domain Sequences for d5ovwh1:

Sequence; same for both SEQRES and ATOM records:

>d5ovwh1 b.1.1.1 (H:24-148) automated matches {Llama (Lama glama) [TaxId: 9844]}
mqlvesggglvqpggslrlscaapestlddyaigwfrqapgkeregvscigssgdstnya
dsvkgrftvsrdnakntvylqmndlrpedtavyycaaahrifggclvihssgyvswgqgt
pvtvs

Timeline for d5ovwh1:

• d5ovwh1 first appeared in SCOPe 2.06, called d5ovwh_
  
• d5ovwh1 was called d5ovwh_ in SCOPe 2.07