Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries) |
Domain d5ovwh1: 5ovw H:24-148 [341341] Other proteins in same PDB: d5ovwa_, d5ovwb_, d5ovwc_, d5ovwd_, d5ovwe_, d5ovwf_, d5ovwg2, d5ovwh2, d5ovwi2, d5ovwj2, d5ovwk2, d5ovwl2 automated match to d4grwf_ complexed with gol |
PDB Entry: 5ovw (more details), 2.65 Å
SCOPe Domain Sequences for d5ovwh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ovwh1 b.1.1.1 (H:24-148) automated matches {Llama (Lama glama) [TaxId: 9844]} mqlvesggglvqpggslrlscaapestlddyaigwfrqapgkeregvscigssgdstnya dsvkgrftvsrdnakntvylqmndlrpedtavyycaaahrifggclvihssgyvswgqgt pvtvs
Timeline for d5ovwh1: