PDB entry 5ovw

View 5ovw on RCSB PDB site
Description: Nanobody-bound BtuF, the vitamin B12 binding protein in Escherichia coli
Class: transport protein
Keywords: Nanobody, Inhibitor, vitamin B12, substrate-binding protein, TRANSPORT PROTEIN
Deposited on 2017-08-30, released 2017-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin B12-binding protein
    Species: Escherichia coli [TaxId:562]
    Gene: btuF, yadT, b0158, JW0154
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ovwa_
  • Chain 'B':
    Compound: Vitamin B12-binding protein
    Species: Escherichia coli [TaxId:562]
    Gene: btuF, yadT, b0158, JW0154
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ovwb_
  • Chain 'C':
    Compound: Vitamin B12-binding protein
    Species: Escherichia coli [TaxId:562]
    Gene: btuF, yadT, b0158, JW0154
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ovwc_
  • Chain 'D':
    Compound: Vitamin B12-binding protein
    Species: Escherichia coli [TaxId:562]
    Gene: btuF, yadT, b0158, JW0154
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ovwd_
  • Chain 'E':
    Compound: Vitamin B12-binding protein
    Species: Escherichia coli [TaxId:562]
    Gene: btuF, yadT, b0158, JW0154
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ovwe_
  • Chain 'F':
    Compound: Vitamin B12-binding protein
    Species: Escherichia coli [TaxId:562]
    Gene: btuF, yadT, b0158, JW0154
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ovwf_
  • Chain 'G':
    Compound: Nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5OVW
    Domains in SCOPe 2.07: d5ovwg_
  • Chain 'H':
    Compound: Nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5OVW
    Domains in SCOPe 2.07: d5ovwh_
  • Chain 'I':
    Compound: Nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5OVW
    Domains in SCOPe 2.07: d5ovwi_
  • Chain 'J':
    Compound: Nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5OVW
    Domains in SCOPe 2.07: d5ovwj_
  • Chain 'K':
    Compound: Nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5OVW
    Domains in SCOPe 2.07: d5ovwk_
  • Chain 'L':
    Compound: Nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5OVW
    Domains in SCOPe 2.07: d5ovwl_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ovwA (A:)
    mkktaiaiavalagfatvaqaasmaaprvitlspantelafaagitpvgvssysdyppqa
    qkieqvstwqgmnlerivalkpdlviawrggnaerqvdqlaslgikvmwvdatsieqian
    alrqlapwspqpdkaeqaaqslldqyaqlkaqyadkpkkrvflqfginppftsgkesiqn
    qvlevcggenifkdsrvpwpqvsreqvlarspqaivitggpdqipkikqywgeqlkipvi
    pltsdwferaspriilaaqqlcnalsqvdsgslevlfqgpggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ovwA (A:)
    aaprvitlspantelafaagitpvgvssysdyppqaqkieqvstwqgmnlerivalkpdl
    viawrggnaerqvdqlaslgikvmwvdatsieqianalrqlapwspqpdkaeqaaqslld
    qyaqlkaqyadkpkkrvflqfginppftsgkesiqnqvlevcggenifkdsrvpwpqvsr
    eqvlarspqaivitggpdqipkikqywgeqlkipvipltsdwferaspriilaaqqlcna
    lsqvd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ovwB (B:)
    mkktaiaiavalagfatvaqaasmaaprvitlspantelafaagitpvgvssysdyppqa
    qkieqvstwqgmnlerivalkpdlviawrggnaerqvdqlaslgikvmwvdatsieqian
    alrqlapwspqpdkaeqaaqslldqyaqlkaqyadkpkkrvflqfginppftsgkesiqn
    qvlevcggenifkdsrvpwpqvsreqvlarspqaivitggpdqipkikqywgeqlkipvi
    pltsdwferaspriilaaqqlcnalsqvdsgslevlfqgpggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ovwB (B:)
    aaprvitlspantelafaagitpvgvssysdyppqaqkieqvstwqgmnlerivalkpdl
    viawrggnaerqvdqlaslgikvmwvdatsieqianalrqlapwspqpdkaeqaaqslld
    qyaqlkaqyadkpkkrvflqfginppftsgkesiqnqvlevcggenifkdsrvpwpqvsr
    eqvlarspqaivitggpdqipkikqywgeqlkipvipltsdwferaspriilaaqqlcna
    lsqvd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ovwC (C:)
    mkktaiaiavalagfatvaqaasmaaprvitlspantelafaagitpvgvssysdyppqa
    qkieqvstwqgmnlerivalkpdlviawrggnaerqvdqlaslgikvmwvdatsieqian
    alrqlapwspqpdkaeqaaqslldqyaqlkaqyadkpkkrvflqfginppftsgkesiqn
    qvlevcggenifkdsrvpwpqvsreqvlarspqaivitggpdqipkikqywgeqlkipvi
    pltsdwferaspriilaaqqlcnalsqvdsgslevlfqgpggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ovwC (C:)
    aaprvitlspantelafaagitpvgvssysdyppqaqkieqvstwqgmnlerivalkpdl
    viawrggnaerqvdqlaslgikvmwvdatsieqianalrqlapwspqpdkaeqaaqslld
    qyaqlkaqyadkpkkrvflqfginppftsgkesiqnqvlevcggenifkdsrvpwpqvsr
    eqvlarspqaivitggpdqipkikqywgeqlkipvipltsdwferaspriilaaqqlcna
    lsqvd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ovwD (D:)
    mkktaiaiavalagfatvaqaasmaaprvitlspantelafaagitpvgvssysdyppqa
    qkieqvstwqgmnlerivalkpdlviawrggnaerqvdqlaslgikvmwvdatsieqian
    alrqlapwspqpdkaeqaaqslldqyaqlkaqyadkpkkrvflqfginppftsgkesiqn
    qvlevcggenifkdsrvpwpqvsreqvlarspqaivitggpdqipkikqywgeqlkipvi
    pltsdwferaspriilaaqqlcnalsqvdsgslevlfqgpggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ovwD (D:)
    aaprvitlspantelafaagitpvgvssysdyppqaqkieqvstwqgmnlerivalkpdl
    viawrggnaerqvdqlaslgikvmwvdatsieqianalrqlapwspqpdkaeqaaqslld
    qyaqlkaqyadkpkkrvflqfginppftsgkesiqnqvlevcggenifkdsrvpwpqvsr
    eqvlarspqaivitggpdqipkikqywgeqlkipvipltsdwferaspriilaaqqlcna
    lsqvd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ovwE (E:)
    mkktaiaiavalagfatvaqaasmaaprvitlspantelafaagitpvgvssysdyppqa
    qkieqvstwqgmnlerivalkpdlviawrggnaerqvdqlaslgikvmwvdatsieqian
    alrqlapwspqpdkaeqaaqslldqyaqlkaqyadkpkkrvflqfginppftsgkesiqn
    qvlevcggenifkdsrvpwpqvsreqvlarspqaivitggpdqipkikqywgeqlkipvi
    pltsdwferaspriilaaqqlcnalsqvdsgslevlfqgpggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ovwE (E:)
    aaprvitlspantelafaagitpvgvssysdyppqaqkieqvstwqgmnlerivalkpdl
    viawrggnaerqvdqlaslgikvmwvdatsieqianalrqlapwspqpdkaeqaaqslld
    qyaqlkaqyadkpkkrvflqfginppftsgkesiqnqvlevcggenifkdsrvpwpqvsr
    eqvlarspqaivitggpdqipkikqywgeqlkipvipltsdwferaspriilaaqqlcna
    lsqvd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5ovwF (F:)
    mkktaiaiavalagfatvaqaasmaaprvitlspantelafaagitpvgvssysdyppqa
    qkieqvstwqgmnlerivalkpdlviawrggnaerqvdqlaslgikvmwvdatsieqian
    alrqlapwspqpdkaeqaaqslldqyaqlkaqyadkpkkrvflqfginppftsgkesiqn
    qvlevcggenifkdsrvpwpqvsreqvlarspqaivitggpdqipkikqywgeqlkipvi
    pltsdwferaspriilaaqqlcnalsqvdsgslevlfqgpggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ovwF (F:)
    aaprvitlspantelafaagitpvgvssysdyppqaqkieqvstwqgmnlerivalkpdl
    viawrggnaerqvdqlaslgikvmwvdatsieqianalrqlapwspqpdkaeqaaqslld
    qyaqlkaqyadkpkkrvflqfginppftsgkesiqnqvlevcggenifkdsrvpwpqvsr
    eqvlarspqaivitggpdqipkikqywgeqlkipvipltsdwferaspriilaaqqlcna
    lsqvd
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5ovwG (G:)
    mkyllptaaagllllaaqpamaqmqlvesggglvqpggslrlscaapestlddyaigwfr
    qapgkeregvscigssgdstnyadsvkgrftvsrdnakntvylqmndlrpedtavyycaa
    ahrifggclvihssgyvswgqgtpvtvsshhhhhhepea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ovwG (G:)
    mqlvesggglvqpggslrlscaapestlddyaigwfrqapgkeregvscigssgdstnya
    dsvkgrftvsrdnakntvylqmndlrpedtavyycaaahrifggclvihssgyvswgqgt
    pvtvss
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5ovwH (H:)
    mkyllptaaagllllaaqpamaqmqlvesggglvqpggslrlscaapestlddyaigwfr
    qapgkeregvscigssgdstnyadsvkgrftvsrdnakntvylqmndlrpedtavyycaa
    ahrifggclvihssgyvswgqgtpvtvsshhhhhhepea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ovwH (H:)
    mqlvesggglvqpggslrlscaapestlddyaigwfrqapgkeregvscigssgdstnya
    dsvkgrftvsrdnakntvylqmndlrpedtavyycaaahrifggclvihssgyvswgqgt
    pvtvss
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5ovwI (I:)
    mkyllptaaagllllaaqpamaqmqlvesggglvqpggslrlscaapestlddyaigwfr
    qapgkeregvscigssgdstnyadsvkgrftvsrdnakntvylqmndlrpedtavyycaa
    ahrifggclvihssgyvswgqgtpvtvsshhhhhhepea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ovwI (I:)
    mqlvesggglvqpggslrlscaapestlddyaigwfrqapgkeregvscigssgdstnya
    dsvkgrftvsrdnakntvylqmndlrpedtavyycaaahrifggclvihssgyvswgqgt
    pvtvss
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5ovwJ (J:)
    mkyllptaaagllllaaqpamaqmqlvesggglvqpggslrlscaapestlddyaigwfr
    qapgkeregvscigssgdstnyadsvkgrftvsrdnakntvylqmndlrpedtavyycaa
    ahrifggclvihssgyvswgqgtpvtvsshhhhhhepea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ovwJ (J:)
    mqlvesggglvqpggslrlscaapestlddyaigwfrqapgkeregvscigssgdstnya
    dsvkgrftvsrdnakntvylqmndlrpedtavyycaaahrifggclvihssgyvswgqgt
    pvtvss
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5ovwK (K:)
    mkyllptaaagllllaaqpamaqmqlvesggglvqpggslrlscaapestlddyaigwfr
    qapgkeregvscigssgdstnyadsvkgrftvsrdnakntvylqmndlrpedtavyycaa
    ahrifggclvihssgyvswgqgtpvtvsshhhhhhepea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ovwK (K:)
    mqlvesggglvqpggslrlscaapestlddyaigwfrqapgkeregvscigssgdstnya
    dsvkgrftvsrdnakntvylqmndlrpedtavyycaaahrifggclvihssgyvswgqgt
    pvtvss
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5ovwL (L:)
    mkyllptaaagllllaaqpamaqmqlvesggglvqpggslrlscaapestlddyaigwfr
    qapgkeregvscigssgdstnyadsvkgrftvsrdnakntvylqmndlrpedtavyycaa
    ahrifggclvihssgyvswgqgtpvtvsshhhhhhepea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ovwL (L:)
    mqlvesggglvqpggslrlscaapestlddyaigwfrqapgkeregvscigssgdstnya
    dsvkgrftvsrdnakntvylqmndlrpedtavyycaaahrifggclvihssgyvswgqgt
    pvtvss