Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Llama glama [TaxId:9844] [236993] (3 PDB entries) |
Domain d4grwf_: 4grw F: [236994] automated match to d1ol0a_ |
PDB Entry: 4grw (more details), 2.55 Å
SCOPe Domain Sequences for d4grwf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4grwf_ b.1.1.1 (F:) automated matches {Llama glama [TaxId: 9844]} vqlvesggglvqpggslrlscaasgftldylaigwfrqapgkeregvscvsssgqytyya dsvkgrftisrdnaestvylqmnslkpedtavyycatdpecyrvrgyyngeydywgqgtq vtvss
Timeline for d4grwf_: