Lineage for d5tm0d_ (5tm0 D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2308123Superfamily a.4.12: TrpR-like [48295] (4 families) (S)
    contains an extra shared helix after the HTH motif
  5. 2308124Family a.4.12.1: Trp repressor, TrpR [48296] (2 proteins)
    intertwined dimer of identical 6-helical subunits
    automatically mapped to Pfam PF01371
  6. 2308163Protein automated matches [254650] (2 species)
    not a true protein
  7. 2308167Species Escherichia coli [TaxId:83334] [340663] (1 PDB entry)
  8. 2308171Domain d5tm0d_: 5tm0 D: [340664]
    automated match to d1co0a_

Details for d5tm0d_

PDB Entry: 5tm0 (more details)

PDB Description: solution nmr structures of two alternative conformations of e. coli tryptophan repressor in dynamic equilibrium
PDB Compounds: (D:) trp operon repressor

SCOPe Domain Sequences for d5tm0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tm0d_ a.4.12.1 (D:) automated matches {Escherichia coli [TaxId: 83334]}
maqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvrivee
llrgemsqrelknelgagiatitrgsnslkaapvelrqwleevllksd

SCOPe Domain Coordinates for d5tm0d_:

Click to download the PDB-style file with coordinates for d5tm0d_.
(The format of our PDB-style files is described here.)

Timeline for d5tm0d_: