Lineage for d5tm0a_ (5tm0 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1984523Superfamily a.4.12: TrpR-like [48295] (4 families) (S)
    contains an extra shared helix after the HTH motif
  5. 1984524Family a.4.12.1: Trp repressor, TrpR [48296] (2 protein domains)
    intertwined dimer of identical 6-helical subunits
    automatically mapped to Pfam PF01371
  6. 1984563Protein automated matches [254650] (2 species)
    not a true protein
  7. 2297362Species Escherichia coli [TaxId:83334] [340663] (1 PDB entry)
  8. 2297416Domain d5tm0a_: 5tm0 A: [340717]
    automated match to d1co0a_

Details for d5tm0a_

PDB Entry: 5tm0 (more details)

PDB Description: solution nmr structures of two alternative conformations of e. coli tryptophan repressor in dynamic equilibrium
PDB Compounds: (A:) trp operon repressor

SCOPe Domain Sequences for d5tm0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tm0a_ a.4.12.1 (A:) automated matches {Escherichia coli [TaxId: 83334]}
maqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvrivee
llrgemsqrelknelgagiatitrgsnslkaapvelrqwleevllksd

SCOPe Domain Coordinates for d5tm0a_:

Click to download the PDB-style file with coordinates for d5tm0a_.
(The format of our PDB-style files is described here.)

Timeline for d5tm0a_:

  • d5tm0a_ appears in periodic updates to SCOPe 2.06 starting on 2017-10-29