PDB entry 5tm0

View 5tm0 on RCSB PDB site
Description: Solution NMR structures of two alternative conformations of E. coli tryptophan repressor in dynamic equilibrium
Class: transcription
Keywords: Structural Genomics, PSI-Biology, Northeast Structural Genomics Consortium, NESG, TRANSCRIPTION
Deposited on 2016-10-12, released 2017-10-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trp operon repressor
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: trpR, Z5995, ECs5351
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5tm0a_
  • Chain 'B':
    Compound: trp operon repressor
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: trpR, Z5995, ECs5351
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5tm0b_
  • Chain 'C':
    Compound: trp operon repressor
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: trpR, Z5995, ECs5351
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5tm0c_
  • Chain 'D':
    Compound: trp operon repressor
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: trpR, Z5995, ECs5351
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5tm0d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5tm0A (A:)
    maqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvrivee
    llrgemsqrelknelgagiatitrgsnslkaapvelrqwleevllksd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5tm0B (B:)
    maqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvrivee
    llrgemsqrelknelgagiatitrgsnslkaapvelrqwleevllksd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5tm0C (C:)
    maqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvrivee
    llrgemsqrelknelgagiatitrgsnslkaapvelrqwleevllksd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5tm0D (D:)
    maqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvrivee
    llrgemsqrelknelgagiatitrgsnslkaapvelrqwleevllksd