SCOPe 2.06: Domain d5tm0d_: 5tm0 D:

Lineage for d5tm0d_ (5tm0 D:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.12: TrpR-like [48295] (4 families)
   contains an extra shared helix after the HTH motif

5. Family a.4.12.1: Trp repressor, TrpR [48296] (2 proteins)
   intertwined dimer of identical 6-helical subunits
   automatically mapped to Pfam PF01371

6. Protein automated matches [254650] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:83334] [340663] (1 PDB entry)

8. Domain d5tm0d_: 5tm0 D: [340664]
   automated match to d1co0a_

Details for d5tm0d_

PDB Entry: 5tm0

PDB Description: solution nmr structures of two alternative conformations of e. coli tryptophan repressor in dynamic equilibrium

PDB Compounds: (D:) trp operon repressor

SCOPe Domain Sequences for d5tm0d_:

Sequence; same for both SEQRES and ATOM records:

>d5tm0d_ a.4.12.1 (D:) automated matches {Escherichia coli [TaxId: 83334]}
maqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvrivee
llrgemsqrelknelgagiatitrgsnslkaapvelrqwleevllksd

Timeline for d5tm0d_:

• d5tm0d_ is new in SCOPe 2.06-stable
  
• d5tm0d_ appears in SCOPe 2.07
  
• d5tm0d_ appears in the current release, SCOPe 2.08