Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) |
Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) |
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (4 proteins) |
Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species) |
Species Thermus aquaticus [TaxId:271] [53121] (13 PDB entries) |
Domain d1bgxt3: 1bgx T:290-422 [33699] Other proteins in same PDB: d1bgxh1, d1bgxh2, d1bgxl1, d1bgxl2, d1bgxt1, d1bgxt2, d1bgxt4 |
PDB Entry: 1bgx (more details), 2.3 Å
SCOP Domain Sequences for d1bgxt3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bgxt3 c.55.3.5 (T:290-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus} spkaleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkear gllakdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraals erlfanlwgrleg
Timeline for d1bgxt3:
View in 3D Domains from other chains: (mouse over for more information) d1bgxh1, d1bgxh2, d1bgxl1, d1bgxl2 |