SCOP 1.59: Domain d1bgxl2: 1bgx L:108-211

Lineage for d1bgxl2 (1bgx L:108-211)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)

7. Species Fab TP7 (mouse), kappa L chain [49063] (2 PDB entries)

8. Domain d1bgxl2: 1bgx L:108-211 [21256]
   Other proteins in same PDB: d1bgxh1, d1bgxl1, d1bgxt1, d1bgxt2, d1bgxt3, d1bgxt4

Details for d1bgxl2

PDB Entry: 1bgx, 2.3 Å

PDB Description: taq polymerase in complex with tp7, an inhibitory fab

SCOP Domain Sequences for d1bgxl2:

Sequence; same for both SEQRES and ATOM records:

>d1bgxl2 b.1.1.2 (L:108-211) Immunoglobulin (constant domains of L and H chains) {Fab TP7 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d1bgxl2:

• d1bgxl2 first appeared (with stable ids) in SCOP 1.55
  
• d1bgxl2 appears in SCOP 1.57
  
• d1bgxl2 appears in SCOP 1.61
  
• d1bgxl2 appears in the current release, SCOPe 2.08