![]() | Class b: All beta proteins [48724] (110 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species) |
![]() | Species Fab TP7 (mouse), kappa L chain [49063] (2 PDB entries) |
![]() | Domain d1bgxh2: 1bgx H:116-209 [21257] Other proteins in same PDB: d1bgxh1, d1bgxl1, d1bgxt1, d1bgxt2, d1bgxt3, d1bgxt4 |
PDB Entry: 1bgx (more details), 2.3 Å
SCOP Domain Sequences for d1bgxh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bgxh2 b.1.1.2 (H:116-209) Immunoglobulin (constant domains of L and H chains) {Fab TP7 (mouse), kappa L chain} akttapsvyplapvssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlss svtvtsstwpsqsitcnvahpasstkvdkkiepr
Timeline for d1bgxh2: