Lineage for d1bgxl1 (1bgx L:1-107)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102905Species Fab TP7 (mouse), kappa L chain [48850] (2 PDB entries)
  8. 102909Domain d1bgxl1: 1bgx L:1-107 [20244]
    Other proteins in same PDB: d1bgxh2, d1bgxl2, d1bgxt1, d1bgxt2, d1bgxt3, d1bgxt4

Details for d1bgxl1

PDB Entry: 1bgx (more details), 2.3 Å

PDB Description: taq polymerase in complex with tp7, an inhibitory fab

SCOP Domain Sequences for d1bgxl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgxl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab TP7 (mouse), kappa L chain}
diqmtqspaimsaspgekvtmtcsasssvsymywyqqkpgssprlliydstnlasgvpvr
fsgsgsgtsysltisrmeaedaatyycqqwstypltfgagtklelk

SCOP Domain Coordinates for d1bgxl1:

Click to download the PDB-style file with coordinates for d1bgxl1.
(The format of our PDB-style files is described here.)

Timeline for d1bgxl1: