![]() | Class b: All beta proteins [48724] (110 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
![]() | Species Fab TP7 (mouse), kappa L chain [48850] (2 PDB entries) |
![]() | Domain d1bgxh1: 1bgx H:5-115 [20245] Other proteins in same PDB: d1bgxh2, d1bgxl2, d1bgxt1, d1bgxt2, d1bgxt3, d1bgxt4 |
PDB Entry: 1bgx (more details), 2.3 Å
SCOP Domain Sequences for d1bgxh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bgxh1 b.1.1.1 (H:5-115) Immunoglobulin (variable domains of L and H chains) {Fab TP7 (mouse), kappa L chain} qesgpglvkpyqslslsctvtgysitsdyawnwirqfpgnklewmgyitysgttdynpsl ksrisitrdtsknqfflqlnsvttedtatyycaryyygywyfdvwgqgttltvss
Timeline for d1bgxh1: