SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5thfb_ (5thf B:)

  1. Root: SCOPe 2.06
  2. 2237529Class h: Coiled coil proteins [57942] (7 folds)
  3. 2238933Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2238934Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2238935Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 protein domains)
  6. 2239322Protein automated matches [254646] (33 species)
    not a true protein
  7. 2289464Species Influenza a virus [TaxId:506350] [332765] (1 PDB entry)
  8. 2289469Domain d5thfb_: 5thf B: [332770]
    Other proteins in same PDB: d5thfa1, d5thfa2, d5thfc1, d5thfc2, d5thfd2, d5thfe1, d5thfe2
    automated match to d4d00d_
    complexed with bma, nag

Details for d5thfb_

PDB Entry: 5thf (more details), 2.59 Å

PDB Description: crystal structure of h3 hemagglutinin with insertion of two amino acids in the 150-loop from the a/hong kong/1/1968 (h3n2) influenza virus
PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d5thfb_:

Sequence, based on SEQRES records: (download)

>d5thfb_ h.3.1.1 (B:) automated matches {Influenza a virus [TaxId: 506350]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqi

Sequence, based on observed residues (ATOM records): (download)

>d5thfb_ h.3.1.1 (B:) automated matches {Influenza a virus [TaxId: 506350]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviekne
kfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfek
tgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqi

SCOPe Domain Coordinates for d5thfb_:

Click to download the PDB-style file with coordinates for d5thfb_.
(The format of our PDB-style files is described here.)

Timeline for d5thfb_:

  • d5thfb_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-06