Lineage for d5thfa1 (5thf A:11-325)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040896Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2040897Protein automated matches [227017] (33 species)
    not a true protein
  7. 2284507Species Influenza a virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [327808] (11 PDB entries)
  8. 2289454Domain d5thfa1: 5thf A:11-325 [332755]
    Other proteins in same PDB: d5thfa2, d5thfb_, d5thfc2, d5thfd1, d5thfd2, d5thfe2, d5thff_
    automated match to d4xkga_
    complexed with bma, nag

Details for d5thfa1

PDB Entry: 5thf (more details), 2.59 Å

PDB Description: crystal structure of h3 hemagglutinin with insertion of two amino acids in the 150-loop from the a/hong kong/1/1968 (h3n2) influenza virus
PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d5thfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5thfa1 b.19.1.0 (A:11-325) automated matches {Influenza a virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
atlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlidal
lgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwtgv
tqnggsnackrgpgsgffsrlnwltksskgstypvlnvtmpnndnfdklyiwgvhhpstn
qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
vkqntlklatgmrnvpe

SCOPe Domain Coordinates for d5thfa1:

Click to download the PDB-style file with coordinates for d5thfa1.
(The format of our PDB-style files is described here.)

Timeline for d5thfa1:

  • d5thfa1 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06