Lineage for d5thfd1 (5thf D:1-176)

  1. Root: SCOPe 2.06
  2. 2237529Class h: Coiled coil proteins [57942] (7 folds)
  3. 2238933Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2238934Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2238935Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 protein domains)
  6. 2239322Protein automated matches [254646] (34 species)
    not a true protein
  7. 2289464Species Influenza a virus [TaxId:506350] [332765] (1 PDB entry)
  8. 2289465Domain d5thfd1: 5thf D:1-176 [332766]
    Other proteins in same PDB: d5thfa1, d5thfa2, d5thfc1, d5thfc2, d5thfd2, d5thfe1, d5thfe2
    automated match to d4d00d_
    complexed with bma, nag

Details for d5thfd1

PDB Entry: 5thf (more details), 2.59 Å

PDB Description: crystal structure of h3 hemagglutinin with insertion of two amino acids in the 150-loop from the a/hong kong/1/1968 (h3n2) influenza virus
PDB Compounds: (D:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d5thfd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5thfd1 h.3.1.1 (D:1-176) automated matches {Influenza a virus [TaxId: 506350]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikgv

SCOPe Domain Coordinates for d5thfd1:

Click to download the PDB-style file with coordinates for d5thfd1.
(The format of our PDB-style files is described here.)

Timeline for d5thfd1:

  • d5thfd1 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06