SCOPe 2.07: Domain d5thfb_: 5thf B:

Lineage for d5thfb_ (5thf B:)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (17 species)
   trimer

7. Species Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [311114] (14 PDB entries)

8. Domain d5thfb_: 5thf B: [332770]
   Other proteins in same PDB: d5thfa1, d5thfa2, d5thfc1, d5thfc2, d5thfd2, d5thfe1, d5thfe2
   automated match to d4d00d_
   complexed with bma, nag

Details for d5thfb_

PDB Entry: 5thf, 2.59 Å

PDB Description: crystal structure of h3 hemagglutinin with insertion of two amino acids in the 150-loop from the a/hong kong/1/1968 (h3n2) influenza virus

PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d5thfb_:

Sequence, based on SEQRES records:

>d5thfb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqi

Sequence, based on observed residues (ATOM records):

>d5thfb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviekne
kfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfek
tgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqi

Timeline for d5thfb_:

• d5thfb_ first appeared in SCOPe 2.06
  
• d5thfb_ appears in the current release, SCOPe 2.08