Class b: All beta proteins [48724] (178 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (57 species) not a true protein |
Species Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [327808] (18 PDB entries) |
Domain d5thfe1: 5thf E:11-325 [332711] Other proteins in same PDB: d5thfa2, d5thfb_, d5thfc2, d5thfd1, d5thfd2, d5thfe2, d5thff_ automated match to d4xkga_ complexed with bma, nag |
PDB Entry: 5thf (more details), 2.59 Å
SCOPe Domain Sequences for d5thfe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5thfe1 b.19.1.0 (E:11-325) automated matches {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]} atlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlidal lgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwtgv tqnggsnackrgpgsgffsrlnwltksskgstypvlnvtmpnndnfdklyiwgvhhpstn qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky vkqntlklatgmrnvpe
Timeline for d5thfe1: