SCOPe 2.07: Domain d5thfa1: 5thf A:11-325

Lineage for d5thfa1 (5thf A:11-325)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (57 species)
   not a true protein

7. Species Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [327808] (18 PDB entries)

8. Domain d5thfa1: 5thf A:11-325 [332755]
   Other proteins in same PDB: d5thfa2, d5thfb_, d5thfc2, d5thfd1, d5thfd2, d5thfe2, d5thff_
   automated match to d4xkga_
   complexed with bma, nag

Details for d5thfa1

PDB Entry: 5thf, 2.59 Å

PDB Description: crystal structure of h3 hemagglutinin with insertion of two amino acids in the 150-loop from the a/hong kong/1/1968 (h3n2) influenza virus

PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d5thfa1:

Sequence; same for both SEQRES and ATOM records:

>d5thfa1 b.19.1.0 (A:11-325) automated matches {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
atlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlidal
lgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwtgv
tqnggsnackrgpgsgffsrlnwltksskgstypvlnvtmpnndnfdklyiwgvhhpstn
qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
vkqntlklatgmrnvpe

Timeline for d5thfa1:

• d5thfa1 first appeared in SCOPe 2.06
  
• d5thfa1 appears in the current release, SCOPe 2.08