SCOPe 2.08: Domain d5lxah2: 5lxa H:133-247

Lineage for d5lxah2 (5lxa H:133-247)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d5lxah2: 5lxa H:133-247 [331710]
   automated match to d4f9lc1
   complexed with ola, olb, zn

Details for d5lxah2

PDB Entry: 5lxa, 3 Å

PDB Description: crystal structure of human adiponectin receptor 2 in complex with a c18 free fatty acid at 3.0 angstrom resolution

PDB Compounds: (H:) Anti-CD30 moab Ki-4 scFv

SCOPe Domain Sequences for d5lxah2:

Sequence; same for both SEQRES and ATOM records:

>d5lxah2 b.1.1.0 (H:133-247) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gsggggsdiqmtqspaslsasvgetvtitcrasgnihnflawyqqkqgkspqvlvynakt
ladgvpsrfsgsgsgtqyslkinslqpedfgsyycqqfwstpytfgggtkleina

Timeline for d5lxah2:

• d5lxah2 first appeared in SCOPe 2.06
  
• d5lxah2 appears in SCOPe 2.07