SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lxah2 (5lxa H:133-247)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (25 species)
    not a true protein
  7. 2028399Species Mouse (Mus musculus) [TaxId:10090] [188198] (535 PDB entries)
  8. 2288409Domain d5lxah2: 5lxa H:133-247 [331710]
    automated match to d4f9lc1
    complexed with ola, olb, zn

Details for d5lxah2

PDB Entry: 5lxa (more details), 3 Å

PDB Description: crystal structure of human adiponectin receptor 2 in complex with a c18 free fatty acid at 3.0 angstrom resolution
PDB Compounds: (H:) Anti-CD30 moab Ki-4 scFv

SCOPe Domain Sequences for d5lxah2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lxah2 b.1.1.0 (H:133-247) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gsggggsdiqmtqspaslsasvgetvtitcrasgnihnflawyqqkqgkspqvlvynakt
ladgvpsrfsgsgsgtqyslkinslqpedfgsyycqqfwstpytfgggtkleina

SCOPe Domain Coordinates for d5lxah2:

Click to download the PDB-style file with coordinates for d5lxah2.
(The format of our PDB-style files is described here.)

Timeline for d5lxah2:

  • d5lxah2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-23