SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lxah1 (5lxa H:-1-121)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2028399Species Mouse (Mus musculus) [TaxId:10090] [188198] (562 PDB entries)
  8. 2288408Domain d5lxah1: 5lxa H:-1-121 [331709]
    automated match to d4f9lc2
    complexed with ola, olb, zn

Details for d5lxah1

PDB Entry: 5lxa (more details), 3 Å

PDB Description: crystal structure of human adiponectin receptor 2 in complex with a c18 free fatty acid at 3.0 angstrom resolution
PDB Compounds: (H:) Anti-CD30 moab Ki-4 scFv

SCOPe Domain Sequences for d5lxah1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lxah1 b.1.1.0 (H:-1-121) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mgevllqqsgpelvkpgasvritckasgytftdfnmdwvkqspgkslewigdfnpnsggs
iynqkfkdkatftvdkssstaymelrsltfedtavyycaretgtawfaywgqgtlvtvsa
agg

SCOPe Domain Coordinates for d5lxah1:

Click to download the PDB-style file with coordinates for d5lxah1.
(The format of our PDB-style files is described here.)

Timeline for d5lxah1:

  • d5lxah1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-23