Lineage for d5gthi_ (5gth I:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026703Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family) (S)
    automatically mapped to Pfam PF02532
  5. 3026704Family f.23.37.1: PsbI-like [161042] (1 protein)
    Pfam PF02532
  6. 3026705Protein Photosystem II reaction center protein I, PsbI [161043] (3 species)
  7. 3026719Species Thermosynechococcus vulcanus [TaxId:32053] [224950] (24 PDB entries)
  8. 3026732Domain d5gthi_: 5gth I: [331574]
    Other proteins in same PDB: d5gtha_, d5gthb_, d5gthc_, d5gthd_, d5gthe_, d5gthf_, d5gthh_, d5gthj_, d5gthk_, d5gthl_, d5gthm1, d5gthm2, d5gtho_, d5gtht_, d5gthu_, d5gthv_, d5gthx_, d5gthz_
    automated match to d4ub8i_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d5gthi_

PDB Entry: 5gth (more details), 2.5 Å

PDB Description: native xfel structure of photosystem ii (dark dataset)
PDB Compounds: (I:) Photosystem II reaction center protein I

SCOPe Domain Sequences for d5gthi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gthi_ f.23.37.1 (I:) Photosystem II reaction center protein I, PsbI {Thermosynechococcus vulcanus [TaxId: 32053]}
metlkitvyivvtffvllfvfgflsgdparnpkrkdle

SCOPe Domain Coordinates for d5gthi_:

Click to download the PDB-style file with coordinates for d5gthi_.
(The format of our PDB-style files is described here.)

Timeline for d5gthi_: