Lineage for d5gthf_ (5gth f:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026744Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) (S)
  5. 3026745Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
    Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
  6. 3026798Protein automated matches [191000] (6 species)
    not a true protein
  7. 3026823Species Thermosynechococcus vulcanus [TaxId:32053] [189914] (16 PDB entries)
  8. 3026838Domain d5gthf_: 5gth f: [331572]
    Other proteins in same PDB: d5gtha_, d5gthb_, d5gthc_, d5gthd_, d5gthe_, d5gthh_, d5gthi_, d5gthj_, d5gthk_, d5gthl_, d5gthm1, d5gthm2, d5gtho_, d5gtht_, d5gthu_, d5gthv_, d5gthx_, d5gthz_
    automated match to d2axtf1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d5gthf_

PDB Entry: 5gth (more details), 2.5 Å

PDB Description: native xfel structure of photosystem ii (dark dataset)
PDB Compounds: (f:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d5gthf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gthf_ f.23.38.1 (f:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
iftvrwvavhtlavptifflgaiaamqfiqr

SCOPe Domain Coordinates for d5gthf_:

Click to download the PDB-style file with coordinates for d5gthf_.
(The format of our PDB-style files is described here.)

Timeline for d5gthf_: