SCOPe 2.08: Domain d5gthf_: 5gth f:

Lineage for d5gthf_ (5gth f:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family)

5. Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
   Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284

6. Protein automated matches [191000] (6 species)
   not a true protein

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189914] (16 PDB entries)

8. Domain d5gthf_: 5gth f: [331572]
   Other proteins in same PDB: d5gtha_, d5gthb_, d5gthc_, d5gthd_, d5gthe_, d5gthh_, d5gthi_, d5gthj_, d5gthk_, d5gthl_, d5gthm1, d5gthm2, d5gtho_, d5gtht_, d5gthu_, d5gthv_, d5gthx_, d5gthz_
   automated match to d2axtf1
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d5gthf_

PDB Entry: 5gth, 2.5 Å

PDB Description: native xfel structure of photosystem ii (dark dataset)

PDB Compounds: (f:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d5gthf_:

Sequence; same for both SEQRES and ATOM records:

>d5gthf_ f.23.38.1 (f:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
iftvrwvavhtlavptifflgaiaamqfiqr

Timeline for d5gthf_:

• d5gthf_ first appeared in SCOPe 2.06
  
• d5gthf_ appears in SCOPe 2.07