SCOPe 2.08: Domain d5gthm1: 5gth M:2-33

Lineage for d5gthm1 (5gth M:2-33)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family)
   automatically mapped to Pfam PF05151

5. Family f.23.35.1: PsbM-like [161034] (2 proteins)
   Pfam PF05151

6. Protein Photosystem II reaction center protein M, PsbM [161035] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189918] (21 PDB entries)

8. Domain d5gthm1: 5gth M:2-33 [344257]
   Other proteins in same PDB: d5gtha_, d5gthb_, d5gthc_, d5gthd_, d5gthe_, d5gthf_, d5gthh_, d5gthi_, d5gthj_, d5gthk_, d5gthl_, d5gthm2, d5gtho_, d5gtht_, d5gthu_, d5gthv_, d5gthx_, d5gthz_
   automated match to d2axtm1
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d5gthm1

PDB Entry: 5gth, 2.5 Å

PDB Description: native xfel structure of photosystem ii (dark dataset)

PDB Compounds: (M:) Photosystem II reaction center protein M

SCOPe Domain Sequences for d5gthm1:

Sequence; same for both SEQRES and ATOM records:

>d5gthm1 f.23.35.1 (M:2-33) Photosystem II reaction center protein M, PsbM {Thermosynechococcus vulcanus [TaxId: 32053]}
evnqlgliatalfvlvpsvfliilyvqtesqq

Timeline for d5gthm1:

• d5gthm1 first appeared in SCOPe 2.07