SCOPe 2.08: Domain d5gthk_: 5gth K:

Lineage for d5gthk_ (5gth K:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families)
   automatically mapped to Pfam PF02533

5. Family f.23.36.1: PsbK-like [161038] (2 proteins)
   Pfam PF02533

6. Protein Photosystem II reaction center protein K, PsbK [161039] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [192450] (26 PDB entries)

8. Domain d5gthk_: 5gth K: [344255]
   Other proteins in same PDB: d5gtha_, d5gthb_, d5gthc_, d5gthd_, d5gthe_, d5gthf_, d5gthh_, d5gthi_, d5gthj_, d5gthl_, d5gthm1, d5gthm2, d5gtho_, d5gtht_, d5gthu_, d5gthv_, d5gthx_, d5gthz_
   automated match to d2axtk1
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d5gthk_

PDB Entry: 5gth, 2.5 Å

PDB Description: native xfel structure of photosystem ii (dark dataset)

PDB Compounds: (K:) Photosystem II reaction center protein K

SCOPe Domain Sequences for d5gthk_:

Sequence; same for both SEQRES and ATOM records:

>d5gthk_ f.23.36.1 (K:) Photosystem II reaction center protein K, PsbK {Thermosynechococcus vulcanus [TaxId: 32053]}
klpeayaifdplvdvlpvipvlflalafvwqaavgfr

Timeline for d5gthk_:

• d5gthk_ first appeared in SCOPe 2.07