SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gthz_ (5gth Z:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2225606Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2225817Superfamily f.17.5: PsbZ-like [161055] (1 family) (S)
    automatically mapped to Pfam PF01737
  5. 2225818Family f.17.5.1: PsbZ-like [161056] (1 protein)
    Pfam PF01737; Ycf9
  6. 2225819Protein Photosystem II reaction center protein Z, PsbZ [161057] (2 species)
  7. 2225825Species Thermosynechococcus vulcanus [TaxId:32053] [192451] (11 PDB entries)
  8. 2288274Domain d5gthz_: 5gth Z: [331575]
    Other proteins in same PDB: d5gthf_, d5gthi_, d5gthv_
    automated match to d4pj0z_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d5gthz_

PDB Entry: 5gth (more details), 2.5 Å

PDB Description: native xfel structure of photosystem ii (dark dataset)
PDB Compounds: (Z:) Photosystem II reaction center protein Z

SCOPe Domain Sequences for d5gthz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gthz_ f.17.5.1 (Z:) Photosystem II reaction center protein Z, PsbZ {Thermosynechococcus vulcanus [TaxId: 32053]}
mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff
vv

SCOPe Domain Coordinates for d5gthz_:

Click to download the PDB-style file with coordinates for d5gthz_.
(The format of our PDB-style files is described here.)

Timeline for d5gthz_:

  • d5gthz_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-17