Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d5u17a2: 5u17 A:179-269 [329628] Other proteins in same PDB: d5u17a1, d5u17b2, d5u17c1, d5u17c3, d5u17d2, d5u17f_, d5u17h_ automated match to d4l4va2 complexed with 7wp, act, gol, na |
PDB Entry: 5u17 (more details), 2.15 Å
SCOPe Domain Sequences for d5u17a2:
Sequence, based on SEQRES records: (download)
>d5u17a2 b.1.1.0 (A:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]} tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty qawasieldpqssnlyschvehsgvhmvlqv
>d5u17a2 b.1.1.0 (A:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]} tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty qawasiesnlyschvehsgvhmvlqv
Timeline for d5u17a2: