SCOPe 2.08: Domain d5u17a2: 5u17 A:179-269

Lineage for d5u17a2 (5u17 A:179-269)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5u17a2: 5u17 A:179-269 [329628]
   Other proteins in same PDB: d5u17a1, d5u17b2, d5u17c1, d5u17c3, d5u17d2, d5u17f_, d5u17h_
   automated match to d4l4va2
   complexed with 7wp, act, gol, na

Details for d5u17a2

PDB Entry: 5u17, 2.15 Å

PDB Description: structure of human mr1-da-6-fp in complex with human mait a-f7 tcr

PDB Compounds: (A:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d5u17a2:

Sequence, based on SEQRES records:

>d5u17a2 b.1.1.0 (A:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty
qawasieldpqssnlyschvehsgvhmvlqv

Sequence, based on observed residues (ATOM records):

>d5u17a2 b.1.1.0 (A:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty
qawasiesnlyschvehsgvhmvlqv

Timeline for d5u17a2:

• d5u17a2 first appeared in SCOPe 2.06
  
• d5u17a2 appears in SCOPe 2.07