SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5u17a1 (5u17 A:1-178)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2163004Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2163005Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2163984Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2163985Protein automated matches [226842] (4 species)
    not a true protein
  7. 2163998Species Human (Homo sapiens) [TaxId:9606] [226044] (59 PDB entries)
  8. 2286326Domain d5u17a1: 5u17 A:1-178 [329627]
    Other proteins in same PDB: d5u17a2, d5u17b1, d5u17b2, d5u17c2, d5u17c3, d5u17d1, d5u17d2, d5u17e1, d5u17e2, d5u17f_, d5u17g1, d5u17g2, d5u17h_
    automated match to d4l4va1
    complexed with 7wp, act, gol, na

Details for d5u17a1

PDB Entry: 5u17 (more details), 2.15 Å

PDB Description: structure of human mr1-da-6-fp in complex with human mait a-f7 tcr
PDB Compounds: (A:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d5u17a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u17a1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

SCOPe Domain Coordinates for d5u17a1:

Click to download the PDB-style file with coordinates for d5u17a1.
(The format of our PDB-style files is described here.)

Timeline for d5u17a1:

  • d5u17a1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-09