SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5u17d2 (5u17 D:111-200)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024239Protein T-cell antigen receptor [49125] (7 species)
  7. 2024240Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (24 PDB entries)
  8. 2286368Domain d5u17d2: 5u17 D:111-200 [329669]
    Other proteins in same PDB: d5u17a1, d5u17a2, d5u17b1, d5u17c1, d5u17c2, d5u17c3, d5u17d1, d5u17e1, d5u17e2, d5u17f_, d5u17g1, d5u17g2, d5u17h_
    automated match to d2f54d2
    complexed with 7wp, act, gol, na

Details for d5u17d2

PDB Entry: 5u17 (more details), 2.15 Å

PDB Description: structure of human mr1-da-6-fp in complex with human mait a-f7 tcr
PDB Compounds: (D:) MAIT T-cell receptor alpha chain

SCOPe Domain Sequences for d5u17d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u17d2 b.1.1.2 (D:111-200) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpsp

SCOPe Domain Coordinates for d5u17d2:

Click to download the PDB-style file with coordinates for d5u17d2.
(The format of our PDB-style files is described here.)

Timeline for d5u17d2:

  • d5u17d2 appears in periodic updates to SCOPe 2.06 starting on 2017-02-09